(£) GBP (Default)
  • ($) USD
  • (€) EUR
  • ($) AUD
  • ($) CAD
  • ($) NZD

FOXO4-DRI Peptide Vial 10mg

FOXO4-DRI 10mg peptide vial Luxembourg

Through many research studies on rats and mice, FOXO4-DRI has shown results in helping with hair loss and hair thinning

£198.36£207.34

SKU PG-FOXO4-DRI-vial Categories ,

FOXO4-DRI Peptide Vial 10mg Luxembourg

In studies, FOXO4-DRI peptide Luxembourg restored the function of the liver and body weight to normal. FOX04-DRI also provides more hair, more movement, a better kidney function to fight senescence and ageing symptoms in quick-ageing (Xpd) mice.

FOXO4-DRI has been seen in research to prevent normal p53 binding of FOXO4, allowing for the removal of senescent cells, enhanced organ function, and “biological age” younger tissue.

FOX04-DRI influences the signals of insulin, control of the cell cycle and oxidative pathways of stress reporting.

FOXO4-DRI is a cell-penetrating peptide that has shown a selective reversal of the effects of ageing in animal study induced apoptosis of senescent cells.

Benefits of FOXO4-DRI 10mg Peptide VialLuxembourg :

  • As demonstrated by clinical studies, treatment with FOX04 DRI appears to be beneficial in delaying the appearance of aged cells in animal models.
  • According to research, female and male pattern baldness in mice may be helped by the FOXO4 DRI hormone. In addition, Luxembourg scientists know from a study that decreasing the generation of senescent cells enhances hair thickness and density, even if the administration of FOXO4 outside of research is still illegal.
  • As animal studies have indicated, FOXO4-DRI can be utilised to enhance the heart’s fundamental functions and prevent age-related alterations in cardiovascular roles.
  • It has been shown that the FOXO4 DRI protein is altered in the brain, leading scientists to suspect that FOXO may be useful in treating and preventing degenerative neurological illnesses. Researchers believe that this peptide may be able to halt the onset of neurodegenerative diseases such as dementia and Alzheimer’s disease.

Amino Acid Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

Molecular Formula: C228H388N86O64

References:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7053614/

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8116695/

 

ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE FOR EDUCATIONAL PURPOSES ONLY

DISCLAIMER: All products sold by PharmaGrade.Store are for research and laboratory use only. These products are not designed for use or consumption by humans or animals. They are not to be classified as a drug, food, cosmetic, or medicinal product and must not be mislabelled or used as such. By purchasing from our Website the buyer accepts and acknowledges the risks involved with handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. Handling and use of these products should be restricted to suitably qualified professionals.

Additional information

size

10mg vial, Kit: 10mg vial, syringes & bac water

Certificates

FOXO4-DRI_Pharmagrade HPLC Certificate

You may also like…