(£) GBP (Default)
  • ($) USD
  • (€) EUR
  • ($) AUD
  • ($) CAD
  • ($) NZD

FOXO4-DRI 10mg Pre-Mixed Peptide

Through many research studies on rats and mice, FOXO4-DRI 10mg pre-mixed peptide Luxembourg has shown results in helping with hair loss and hair thinning.

FOX-04 DRI 10mg Pre-mixed Pen kit contains: 1 x Cartridge (premixed with Bacteriostatic Water), 1 x Cartridge Pen with 3 Pen Needle Tips, plus a Pen Carry Case.

FOX-04 DRI 10mg Single Pre-mixed Cartridges: 1, 2 or 3 x Cartridge (premixed with Bacteriostatic Water) plus 3 Pen Needle Tips. (Single mixed cartridges do not contain the pen or case)

Get a 10% discount on 3 cartridge pack.

£202.13£545.75

SKU PG-FOXO4-DRI-Pen Categories ,

Buy FOXO4-DRI 10mg Pre-Mixed Peptide Luxembourg

In  studies FOXO4-DRI 10mg pre-mixed peptide Luxembourg restored the function of the liver and body weight to normal. FOXO4-DRI research indicates it also has the ability to provide more hair, more movement, a better kidney function to fight senescence and ageing symptoms in quick-ageing (Xpd) mice.

FOXO4-DRI has been seen in research aimed at preventing normal p53 binding of FOXO4, allowing for the removal of senescent cells, enhanced organ function, and “biological age” younger tissue.

FOXO4-DRI influence the signals of insulin, control of the cell cycle and oxidative pathways of stress reporting.

FOXO4-DRI is a cell penetrating peptide that has shown a selective reversal of the effects of ageing in animal study induced apoptosis of senescent cells.

Benefits of FOXO4-DRI 10mg Pre-Mixed Peptide Luxembourg

  • As demonstrated by clinical studies, treatment with FOX04 DRI appears to be beneficial in delaying the appearance of aged cells in animal models.
  • According to research, female and male pattern baldness in mice may be helped by the FOXO4 DRI hormone. In addition, Luxembourg scientists know from a study that decreasing the generation of senescent cells enhances hair thickness and density, even if the administration of FOXO4 outside of research is still illegal.
  • As animal studies have indicated, FOXO4-DRI can be utilised to enhance the heart’s fundamental functions and prevent age-related alterations in cardiovascular roles.
  • It has been shown that the FOXO4 DRI protein is altered in the brain, leading scientists to suspect that FOXO may be useful in treating and preventing degenerative neurological illnesses. Researchers believe that this peptide may be able to halt the onset of neurodegenerative diseases such as dementia and Alzheimer’s disease.

Amino Acid Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH

Molecular Formula: C228H388N86O64

References:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8116695/

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7053614/

Benefits of Pharma Grade Store Pre-mixed Peptide Pens

Pre-mixed pen kits include a cartridge, have a dosage dial, and single-use needle tips inside the case. As a result, pens are easier, more accurate, and more convenient than a vial and syringe. Single cartridges can be used to top up your kit.

Other benefits include:

  • Usability, especially for those new to research peptides.
  • The pens are portable and convenient.
  • The ability to set doses precisely using a dial.
  • Reduces the stress of mixing correctly
  • Because they are pre-mixed, they save time.
  • There are various accessories to facilitate storage and use.

ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE FOR EDUCATIONAL PURPOSES ONLY

DISCLAIMER: All products sold by PharmaGrade.Store are for research and laboratory use only. These products are not designed for use or consumption by humans or animals. They are not to be classified as a drug, food, cosmetic, or medicinal product and must not be mislabelled or used as such. By purchasing from our Website the buyer accepts and acknowledges the risks involved with handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. Handling and use of these products should be restricted to suitably qualified professionals.

Additional information

size

Pen Kit with 1 pre-mixed cartridge, 1 single mixed cartridge, 2 pre-mixed cartridges, 3 pre-mixed cartridges

Pen instructions

All pre-mixed cartridges are mixed with 2ml bacteriostatic water, pens will release approximately 0.5ml per 60 dials on the pen (one full pen)

To achieve the number of micrograms (mcg) that 1 dial on the pen will release you will need to simply divide the amount of product:

2mg = 2000mcg

5mg = 5000mcg

by the full amount of pen dials (which will always be 240)

E.g., 5000mcg divided by 240 = 20.83, therefore 1 dial on the pen for all 5mg products will release approximately 20.83mcg.

Certificates

FOXO4-DRI_Pharmagrade HPLC Certificate